PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G2638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 292aa    MW: 33195.3 Da    PI: 7.8436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G2638genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.2e-173380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd  lv++++++G g+W+  a++ g++Rt+k+c++rw++yl
      Gh_D12G2638 33 RGPWTIEEDSVLVHYIARHGEGRWNFLAKHSGLRRTGKSCRLRWLNYL 80
                     89********************************************97 PP

2Myb_DNA-binding53.74.9e-1786129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE+ l+++++ +lG++ W++Ia++++ gRt++++k++w++
      Gh_D12G2638  86 RGNLTAEEQFLILELHSKLGNR-WSKIAQHLP-GRTDNEIKNYWRT 129
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7212880IPR017930Myb domain
SuperFamilySSF466897.35E-3131127IPR009057Homeodomain-like
SMARTSM007171.8E-133282IPR001005SANT/Myb domain
PfamPF002492.1E-153380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-223487IPR009057Homeodomain-like
CDDcd001672.51E-103580No hitNo description
PROSITE patternPS0017504857IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.04981135IPR017930Myb domain
SMARTSM007172.6E-1585133IPR001005SANT/Myb domain
PfamPF002491.6E-1586129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2488134IPR009057Homeodomain-like
CDDcd001671.07E-1190129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTSPSSSSSS SLKKTSTSCS EDEGDHHQQQ LRRGPWTIEE DSVLVHYIAR HGEGRWNFLA  60
KHSGLRRTGK SCRLRWLNYL KPDVKRGNLT AEEQFLILEL HSKLGNRWSK IAQHLPGRTD  120
NEIKNYWRTR VQKQARQLNI DANSAAFKNI LRYYWMPRLV QKMKELSSPC FSTTVIPRNQ  180
PLMKTDYVDG NSCVSSLEHV DDMKMSQFGI FGSNDCNSNA LAKDWYGYVG DNGSYCHGME  240
TINMASTSAL VGEGFPTPAA DCHLADDNWV NDGFVDGIWS MGELWELRNA LH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28311355108B-MYB
1h8a_C5e-283013524128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ2013040.0HQ201304.1 Gossypium hirsutum MYB146 (MYB146) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440295.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0D2RPA10.0A0A0D2RPA1_G
STRINGPOPTR_0015s03770.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2429834
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.13e-78myb domain protein 116